Creating records is not a new thing for A R Rahman. He did it once again on Saturday when the theme song composed by him for the Common Wealth Games was released at a glittering ceremony in New Delhi.
If one has to go by reports, within two hours of the song’s release, it was downloaded more than 7,000 times. As Rahman croons ‘Khelo, jeeyo, hey-o, let's go…’, the rousing chorus takes the song forward, thereby giving an emotional appeal.
On Saturday, the Oscar-Grammy winner sung the song for around five minutes in front of a gathering which included Delhi Chief Minister Sheila Dikshit, her Haryana counterpart Bhupinder Singh Hooda and CWG Organising Committee Chairman Suresh Kalmadi.
“I feel honoured to get the opportunity to compose the theme song for the mega-event. It was not an easy task. I had started composing it six months ago and finished just last night,” the Mozart of Madras said.
A beaming Kalmadi hailed the launch of the theme song as a good beginning to the hosting of successful Games. “A well beginning is the half job done. Now onwards you will listen this song day in and day out,” he said.
For more yaaradhu yaaro, tamil new gana songs Visite our site tamilmp3songslyrics.com
46ec9a62-9ddb-43a3-92d9-3efc5d5c4719|0|.0
The September month is going to be a hyper active month as many of the curious films getting released to avoid competing with Endhiran October. One long awaited movie releasing in September is Indira Innovations 'Dhrohi'.
The gangster saga stars Srikanth and Vishnu in stellar characters. The female quotient is also high as three heroines are lighting up the film. Puja, Poorna and Poonam Bajawa. More so the film is directed by K.Sudha Prasad and produced by Mano Akkineni.
With this, September will also become a memorable month for 'Vennila Kabadi Kuzhu' Vishnu as two of his films are hitting theatres in the first two weeks. Great going Vishnu.
For more tamilfilmsamisongslyricsinenglish, appaditamilfilmwhichyearrelease Visite our site tamilmp3songslyrics.com
65ffe201-2cb4-485f-8ae6-46978b297e83|0|.0
The comedy caper 'Bale Pandiya' is releasing on September 3rd. The laugh riot was recently certified with an 'U' certificate there by confirming the film for the entire family to enjoy.
Starring Vishnu, Pia, Gigran and others 'Bale Pandiya' is a feel good film and has colourful moments throughout. Siddharth Chandrasekar is the director who assures"never a dull moment" in the film.
Along with the announcement of the release date the official website of the film was also launched by actor Surya today. Visit 'Bale Pandiy'
Meanwhile Vishnu is also having a handful this month. The promisig actor will have his next release 'Drohi' in the second week of September.
For more mundhinam paartheney lyrics, jaya jaya shakti Visite our site tamilmp3songslyrics.com
06c3476d-9454-48bd-8045-e67ae04f6a2c|0|.0
Title : Moscowin Kaveri
Director : Ravi Varma
Producer : D.Ramesh Babu
Music Director : S. Thaman
Actors : Rahul Ravindran, Samantha, Seeman, Santhanam, Harsha Vardhan
Releasing Date : Aug 27, 2010
The Story : Moscowin Kaveri story is about two lovers who are as different as Tamil Nadu’s Kaveri and Moscow’s Moscow River. The Moscow River is cool and placid, whereas Kaveri River is warm and has strong currents.
For more ragasiyam ondru sonnal, poarkkalam Visite our site tamilmp3songslyrics.com
da53ee75-09fc-4795-8b50-ede422b2ef32|1|1.0
Title : Naan Mahan Alla
Director : Susindran
Producer : K.E. Gnyanavel Raja, Dayanidhi Azhagiri
Music Director : Yuvan Shankar Raja
Lyrics : Na. Muthukumar, Yugabarathi, Francis Kriba
Hero : Karthi
Heroni : Kajal Aggarwal
Other Actors : Singam Puli, Neelima, Lakshmi Ramakrishnan, Jayaprakash
The Story : Director Susindran was pretty overconfident that Naan Mahan Alla would be an exceptional flick focalizing on rapid rise of crime rates in Chennai. But, what should have been a crime thriller turns into sluggish drama with predictable narration. In all likelihood, Naan Mahan Alla carries such hackneyed plot and offers nothing special to the audiences.
Buzz up!
The film revolves around Jeeva (Karthi), a freewheeling guy with no worries in life. His family members and friends keep him invigorated over the times. Jeeva comes across the gorgeous Priya (Kajal Aggarwal) and falls in love at first sight and indeed impresses her. When everything is set to go on paths of happiness, Jeeva’s life is turned upside down when his father (Jayaprakash) is stabbed to death by group of strangers. What follows next is Jeeva’s mission of trapping the goons, who were responsible not alone for his father’s death, but are serial killers.
The complete first hour (80mins) has nothing to do with the journey as Susindran established the conflict merely at the point of intermission. It looks like the filmmaker wanted to keep the first half with fun, frolic and romance and the latter half with complete contrast. For sure, audiences would feel like watching two different movies due to lack of relevance. The major drawback of the film is Susindran’s amateur way of handling certain sequences. Chennai’s most raucous roughneck and his henchmen killed by youngsters are unbelievable. Maybe, they’re serial killers, but that doesn’t mean they can bump off the most dangerous hooligans just like that.
Having shot the complete film in Chennai, Susindran should have made sure there are continuities between locations in the same sequences. Watch out for the scene where Karthi chases one of the culprits. The chase starts across the lanes of housing boards near Chetpet Railway Station and ends at Perambur Railway Station (The station name can be spotted). Often showing Karthi smiling at kids is unwanted. Director Susindran established the protagonist’s kind-heartedness of buying chocolates for loan borrowers’ kid. This was more than enough to delineate him.
Technically, the background score by Yuvan Shankar Raja is magnificent and the song ‘Iragai Pole’ is a foot-tapping number. Mathi’s cinematography is okay as he doesn’t try for innovative placements. His picturing style of songs and climax fight sequence is over the top. Editing by Kasi Viswanathan is perfect.
Basically, if you’re expecting Naan Mahan Alla to be a serious movie
with a strong storyline, you’re sure to get disappointed. It’s a time worn of script of hero putting an end to villains. The film can be watched once and it’s just an average show with few violence sequences harshly shown.
When compared to his previous films Paruthiveeran and Aayirathil Oruvan, the actor fails to get himself over the top. Karthi has to keep himself cognizant over choosing some good scripts. Having delivered a commendable showpiece Vennila Kabadi Kulu, Susindran bashes down our hopes with a flimsy tale.
For more mundhinam paartheney lyrics, yaaradhu yaaro Visite our site tamilmp3songslyrics.com
67327b59-6cc6-4748-82b8-0a6682da597d|0|.0
Kajal Agarwal is all praise for her ‘Naan Mahan Alla’ co-star Karthi Sivakumar even as the film directed by Suseendiran is hitting the screens in a big way today. “He is a thorough professional,” she says.
“Karthi is full of energy. Working with him is nothing short of a delight. He would spread his positive vibes to every member of the unit and made every day of shooting an interesting thing,” the actress says.
Throwing light on her character in the film, she says, “I play Priya, a girl next door. She is not the usual heroine, but silent, calm and reserved. I am satisfied with the way my character is shaped up in the movie.”
Expressing gratitude to Suseendiran, she says, “But for him, I wouldn’t have landed up as the heroine of Naan Mahan Alla. It is a very interesting script which will bring on screen a different side of Chennai.”
For more ragasiyam ondru sonnal, poarkkalam Visit our site tamilmp3songslyrics.com
76cf2058-38c9-4d77-aba4-f6bb38b4a931|0|.0
Director Murugados's '7-am Arivu' has got bigger with a Hindi version also officially added now. The film which was meant to be in Tamil and Telugu will now have a Hindi version also and that will serve as a re-launch pad for Shruthi in Bollywood.
It is said that, Kamal Haasan was the first choice of Murugadoss for '7-am Arivu' but when he approached, Kamal suggested to work with Shruthi instead. As Shruthi's Bollywood career hasn't taken off satisfactorily they have decided to use this film as a second launch.
Shruthi Kamal’s debut film in Bollywood ‘Luck’ was a commercial flop and this time it seems the father Kamal is taking the responsibility of getting things right for her daughter in Bollywood.
The director first decided "suriya is the hero of '7-Am Arivu'. But now it changed ,the hero of the 7-Am Arivu is Hindi Actor instead of Suriya.
For more thittakudi lyrics, puruvathai nee Visite our site tamilmp3songslyrics.com
abe5a753-9b2d-49f3-8990-6ea1ddd7235b|0|.0
It seems Bollywood is coming closer to Suriya even as he is distancing himself from the country’s numero uno film industry.
Only recently, the actor, who is making his Hindu debut with Ram Gopal Varma’s ‘Raktha Charithra’, clarified that south Indian cinema is close to his heart and his focus would always be on south and not Bollywood.
“I am not looking at making a full-fledged career in Bollywood. And I am not shifting my base to Mumbai. I have never pushed myself for Hindi cinema. If I get to do different roles that excite me then I will surely love to do Hindi movies. But I will not stop doing films down south,” he said.
Meanwhile, the latest news in the trade is that ‘7 am Arivu’, the actor’s forthcoming film directed by A.R. Murugadoss, will be made in Hindi as well. Producer Udhayanidhi Stalin wants to release the movie in Tamil, Telugu and Hindi simultaneously, sources say.
Interestingly, making trilinguals is becoming a trend in Kollywood of late, at least for ‘big films’. Two other similar projects which are currently in the pipeline are Suriya’s own ‘Raktha Charithra’ and Superstar Rajinikanth’s ‘Endhiran’.
For more rafasiyam ondru sonnal, poarkkalam Visite our site tamilmp3songslyrics.com
4d62f3e5-c135-4fab-824f-28504708f9b2|0|.0
Title : Inidhu Inidhu
Director : K.V.Guhan
Producer : Prakash Raj
Music Director : Mickey J Meyar
Cast : Narayan, Arun lswaran
The Story : Inidhu Inidhu is a remake of telugu blockbuster "HAPPY DAYS". Eight young talented new faces are set to act in this film. The cast includes Narayan (Tyson), Sonia (Shravs), Arun Iswaran (Sidhu), Reshmi Menon (Madhu), Vimal (Vimal), Bennas (Appu), SharmA (Shankar), Gia Umar (Sangeetha), Sunny Sawrav (Sanny Balboa), Abhishek (Arjun), Krishna (Sanjay), Arun (Ajay).
The ensemble makes all the difference in the film about college, relationships, friendship and brings about family bonding and values. A perfect potpori of emotions, drama, humor and overall fun...
For more thittakudi lyrics, puruvathai nee Visite our site tamilmp3songslyrics.com
b9f30c52-6f32-40a5-aea3-761db987cdb8|0|.0
Ilayathalapathy Vijay's 51st movie 'Kaaval Kaadhal' which was seriously considered for a rename has been titled 'Kaavalan'. The movie 'Kaavalan' is directed by Siddique and the film stars Vijay and Asin in the lead roles. The previous title 'Kaadhal' was not much liked by the fans and now it has been changed as 'Kaavalan'.
The film is nearing its completion and it is a remakes of the Malayalam hit 'Bodyguard'. 'Kaavalan' is completely a prefect blend of comedy and action and this movie is a re-entry for Asin to Kollywood after a long gap. Director Siddique said "chidambaram bought releasing order of this movie".
For more tamil songs, songs lyrics Visit our site tamilmp3songslyrics.com
5a825e25-7271-455a-91b7-9e9a5dd5685f|0|.0